PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01600.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family B3
Protein Properties Length: 528aa    MW: 59962.9 Da    PI: 8.9539
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01600.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.81.9e-13241021297
                              HTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                       B3  12 ksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                               ++ l +p  f+ +h  g ++   kt +l++  s ++W vk+      ++  lt+GW+eF+ a++L++gD+ +F+++g++ f  +v
  Rsa1.0_01600.1_g00008.1  24 HTH-LNIPVAFFLKHvqG-SNDHIKTAKLRTdASAKTWLVKI------DSLKLTDGWEEFAVAHELRVGDITIFRHEGEMVF--HV 99 
                              444.99*********963.4444568888775888*******......4556***********************9998888..88 PP

                              EEE CS
                       B3  95 kvf 97 
                              ++f
  Rsa1.0_01600.1_g00008.1 100 TAF 102
                              776 PP

2B376.43.1e-24152245599
                              -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                       B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                               +++++l+ +rl +p++fa+++g++k ++k+++l +e+grsW+++l+y++++ +++ + GW++F+ +ng+k g   +F+l++ +++
  Rsa1.0_01600.1_g00008.1 152 NVSPSSLRFDRLHIPNSFARSNGLNKMSGKEIVLLNEEGRSWNFNLQYNRTGMSTYVRPGWRRFCAENGMKKGHRYTFELVR-KSA 236
                              56778888899*********************************************************************98.999 PP

                              ..EEEEE-S CS
                       B3  91 elvvkvfrk 99 
                               +v++++r+
  Rsa1.0_01600.1_g00008.1 237 PPVFRLCRA 245
                              9******97 PP

3B355.31.2e-17267357799
                              .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                       B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                              +s++l ++ l+l ++f++++g++k  s ++t+++e+g +W++ l++  + +r++l+ GWk F++ ng+k+ D++++kl++ ++ ++
  Rsa1.0_01600.1_g00008.1 267 SSNSLINDKLYLQRQFITANGLEKGFS-EITVKNEWGGRWSLPLRHYESVNRTYLGPGWKTFCQVNGIKAEDSFMLKLVE-TGNKP 350
                              677888999**************9887.*************************************************998.77779 PP

                              EEEEE-S CS
                       B3  93 vvkvfrk 99 
                              v+ ++++
  Rsa1.0_01600.1_g00008.1 351 VLLLCSS 357
                              9998875 PP

4B348.91.1e-15432525397
                              EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
                       B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                                +++ ++lk++ l lp +f++++g++  ++k+++l  ++g ++  v l  +k+ gr+ ++kGW+eF +a+g+k+g++++++l+++
  Rsa1.0_01600.1_g00008.1 432 RLTLTQNALKTSVLHLPVSFTRANGIN--KPKKIMLLGKDGvKKQVVDLLKTKSTGRMRIGKGWREFRDAHGVKVGESFLLELIWE 515
                              5667889999999************99..5669********7777778888999999***************************** PP

                              SEE..EEEEE CS
                       B3  88 sefelvvkvf 97 
                              +e+ +v+k++
  Rsa1.0_01600.1_g00008.1 516 EEAIPVLKFC 525
                              9999999988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.9E-209107IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.9E-1710111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.20912105IPR003340B3 DNA binding domain
CDDcd100171.93E-1313102No hitNo description
SMARTSM010197.8E-2015105IPR003340B3 DNA binding domain
PfamPF023625.3E-82699IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-22142244IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.18E-19144248IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086315.284148246IPR003340B3 DNA binding domain
SMARTSM010192.6E-27149246IPR003340B3 DNA binding domain
CDDcd100171.19E-17149244No hitNo description
PfamPF023627.0E-23151245IPR003340B3 DNA binding domain
SuperFamilySSF1019361.22E-13258357IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.985261357IPR003340B3 DNA binding domain
SMARTSM010191.1E-17262358IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-14266357IPR015300DNA-binding pseudobarrel domain
PfamPF023622.0E-16266357IPR003340B3 DNA binding domain
CDDcd100177.51E-12267356No hitNo description
Gene3DG3DSA:2.40.330.108.8E-16425526IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-17426525IPR015300DNA-binding pseudobarrel domain
CDDcd100174.02E-13429525No hitNo description
SMARTSM010193.2E-20430528IPR003340B3 DNA binding domain
PROSITE profilePS5086311.716430527IPR003340B3 DNA binding domain
PfamPF023621.1E-14430525IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MADDQSLHSH TNPHFFQPLL PGFHTHLNIP VAFFLKHVQG SNDHIKTAKL RTDASAKTWL  60
VKIDSLKLTD GWEEFAVAHE LRVGDITIFR HEGEMVFHVT AFGPSFCDIQ YTTSASSHNI  120
NDDCQGERRK RVKKNPRTKE EPSSDQSQFV ANVSPSSLRF DRLHIPNSFA RSNGLNKMSG  180
KEIVLLNEEG RSWNFNLQYN RTGMSTYVRP GWRRFCAENG MKKGHRYTFE LVRKSAPPVF  240
RLCRAEHDPK PAPESSVHHS YYVGSVSSNS LINDKLYLQR QFITANGLEK GFSEITVKNE  300
WGGRWSLPLR HYESVNRTYL GPGWKTFCQV NGIKAEDSFM LKLVETGNKP VLLLCSSNRG  360
KAPLECSEGS DDVNSLSSDT SSGDDSREES QESEEESLED DSRSKECFEV EKRKSSLRCI  420
CSSLYSKHRF LRLTLTQNAL KTSVLHLPVS FTRANGINKP KKIMLLGKDG VKKQVVDLLK  480
TKSTGRMRIG KGWREFRDAH GVKVGESFLL ELIWEEEAIP VLKFCTEL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013639399.10.0PREDICTED: B3 domain-containing protein REM17-like
SwissprotQ84WP31e-153REM17_ARATH; B3 domain-containing protein REM17
TrEMBLA0A0D3CDE60.0A0A0D3CDE6_BRAOL; Uncharacterized protein
STRINGBra024696.1-P0.0(Brassica rapa)
STRINGBra024697.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM57811648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26680.11e-144B3 family protein